Recombinant Human Calsequestrin 1 protein (ab114404)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QEGLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQ FEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLTEVDSMYVFKG DE
    • Molecular weight
      37 kDa including tags
    • Amino acids
      35 to 136
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calmitin
    • Calmitine
    • Calsequestrin
    • Calsequestrin 1 (fast twitch, skeletal muscle)
    • Calsequestrin, cell
    • Calsequestrin, skeletal muscle isoform
    • Calsequestrin-1
    • CASQ
    • Casq1
    • CASQ1_HUMAN
    • PDIB1
    • skeletal muscle isoform
    see all
  • Function
    Calsequestrin is a high-capacity, moderate affinity, calcium-binding protein and thus acts as an internal calcium store in muscle. The release of calcium bound to calsequestrin through a calcium release channel triggers muscle contraction. Binds 40 to 50 moles of calcium. Also binds laminin.
  • Sequence similarities
    Belongs to the calsequestrin family.
  • Cellular localization
    Sarcoplasmic reticulum lumen. Mitochondrion. This isoform of calsequestrin occurs in the sarcoplasmic reticulum's terminal cisternae luminal spaces of fast skeletal muscle cells. Also mitochondrial according to PubMed:7945294.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab114404, stained with Coomassie Blue

References

ab114404 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114404.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up