Recombinant Human Calsequestrin protein (ab114404)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP31415
    • SpeciesHuman
    • SequenceQEGLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQ FEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLTEVDSMYVFKG DE
    • Molecular weight37 kDa including tags
    • Amino acids35 to 136

Specifications

Our Abpromise guarantee covers the use of ab114404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calmitin
    • Calsequestrin
    • Calsequestrin 1
    • Calsequestrin 1 fast twitch skeletal muscle
    • Calsequestrin 2
    • Calsequestrin 2 fast twitch cardiac muscle
    • Calsequestrin cardiac muscle isoform
    • Calsequestrin skeletal muscle isoform
    • Calsequestrin-1
    • Cardiac calsequestrin 2
    • CASQ 1
    • CASQ 2
    • Casq1
    • CASQ1_HUMAN
    • PDIB1
    • PDIB2
    • Skeletal muscle calsequestrin 1
    • skeletal muscle isoform
    see all
  • FunctionCalsequestrin is a high-capacity, moderate affinity, calcium-binding protein and thus acts as an internal calcium store in muscle. The release of calcium bound to calsequestrin through a calcium release channel triggers muscle contraction. Binds 40 to 50 moles of calcium. Also binds laminin.
  • Sequence similaritiesBelongs to the calsequestrin family.
  • Cellular localizationSarcoplasmic reticulum lumen. Mitochondrion. This isoform of calsequestrin occurs in the sarcoplasmic reticulum's terminal cisternae luminal spaces of fast skeletal muscle cells. Also mitochondrial according to PubMed:7945294.
  • Information by UniProt

Recombinant Human Calsequestrin protein images

  • 12.5% SDS-PAGE analysis of ab114404, stained with Coomassie Blue

References for Recombinant Human Calsequestrin protein (ab114404)

ab114404 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114404.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"