Recombinant Human CaMKI gamma protein (ab163513)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TQLPCQHGRRPTAPGGRSLNCLVNGSLHISSSLVPMHQGSLAAGPCGCCS SCLNIGSKGKSSYCSEPTLLKKANKKQNFKSEVMVPVKASGSSHCRAGQT GVCLIM
    • Amino acids
      371 to 476
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163513 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium/calmodulin dependent protein kinase type 1G
    • Calcium/calmodulin-dependent protein kinase I-gamma
    • Calcium/calmodulin-dependent protein kinase Ig
    • Calcium/calmodulin-dependent protein kinase type 1G
    • CaM kinase I gamma
    • CaM kinase IG
    • CaM-KI gamma
    • CaMK like CREB kinase III
    • CaMK-like CREB kinase III
    • Camk1g
    • CaMKI gamma
    • CaMKIG
    • CLICK III
    • CLICK3
    • dJ272L16.1
    • KCC1G_HUMAN
    • VWS1
    see all
  • Function
    Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. In vitro phosphorylates transcription factor CREB1.
  • Tissue specificity
    Mainly expressed in brain with small amounts in skeletal muscles, kidney, spleen and liver. Strongly expressed in forebrain neocortex, striatum and limbic system.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
    Contains 1 protein kinase domain.
  • Domain
    The autoinhibitory domain overlaps with the calmodulin binding region and interacts in the inactive folded state with the catalytic domain as a pseudosubstrate.
  • Post-translational
    modifications
    May be prenylated on Cys-473.
  • Cellular localization
    Cytoplasm. Golgi apparatus membrane. Cell membrane.
  • Information by UniProt

Images

  • ab163513 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163513 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163513.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up