Recombinant Human CaMKII beta protein (ab158020)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACI AYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPL
    • Amino acids
      405 to 502
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158020 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium/calmodulin dependent protein kinase (CaM kinase) II beta
    • Calcium/calmodulin dependent protein kinase II beta
    • Calcium/calmodulin dependent protein kinase IIB
    • Calcium/calmodulin dependent protein kinase type II beta chain
    • calcium/calmodulin-dependent protein kinase II beta
    • Calcium/calmodulin-dependent protein kinase type II subunit beta
    • CAM 2
    • CaM kinase II beta chain
    • CaM kinase II beta subunit
    • CaM kinase II subunit beta
    • CaM-kinase II beta chain
    • CAM2
    • CAMK 2
    • CAMK 2B
    • CaMK II beta subunit
    • CaMK II subunit beta
    • CaMK-II subunit beta
    • CAMK2
    • CaMK2 beta
    • Camk2b
    • CAMKB
    • CaMKII beta subunit
    • CaMKIIB
    • KCC2B_HUMAN
    • MGC29528
    • Proline rich calmodulin dependent protein kinase
    • proline rich calmodulin-dependent protein kinase
    see all
  • Function
    CaM-kinase II (CAMK2) is a prominent kinase in the central nervous system that may function in long-term potentiation and neurotransmitter release. Member of the NMDAR signaling complex in excitatory synapses, it may regulate NMDAR-dependent potentiation of the AMPAR and synaptic plasticity.
  • Tissue specificity
    Widely expressed. Expressed in adult and fetal brain. Expression is slightly lower in fetal brain.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab158020 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158020 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158020.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up