Recombinant Human CaMKII delta protein (ab158022)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEI IKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFE NALSKSNKPI
    • Amino acids
      301 to 410
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158022 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium / calmodulin dependent protein kinase 2 delta
    • Calcium / calmodulin dependent protein kinase II delta
    • calcium/calmodulin-dependent protein kinase (CaM kinase) II delta
    • calcium/calmodulin-dependent protein kinase type II delta chain
    • Calcium/calmodulin-dependent protein kinase type II subunit delta
    • CAM kinase 2 delta
    • CAM kinase II delta
    • CaM kinase II delta subunit
    • CaM kinase II subunit delta
    • CaM-kinase II delta chain
    • CAMK 2d
    • CaMK-II delta subunit
    • CaMK-II subunit delta
    • CAMK2D
    • CAMKD
    • CAMKI
    • KCC2D_HUMAN
    • RATCAMKI
    see all
  • Function
    CaM-kinase II (CAMK2) is a prominent kinase in the central nervous system that may function in long-term potentiation and neurotransmitter release.
  • Tissue specificity
    Expressed in cardiac muscle and skeletal muscle. Isoform Delta 3, isoform Delta 2, isoform Delta 8 and isoform Delta 9 are expressed in cardiac muscle. Isoform Delta 11 is expressed in skeletal muscle.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab158022 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158022 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158022.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up