Recombinant Human CAMKIV protein (ab119450)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ16566
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMLKVTVPSCSASSCSSVTASAAPGTA SLVPDYWIDGSNRDALSDFFEVESELGRGATSIVYRCKQKGTQKPYALKV LKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGEL FDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPA PDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWS VGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDL VRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKL KAAVKAVVASSRLGSASSSHGSIQESHKASRDPSPIQDGNEDMKAIPEGE KIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIK VADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
    • Molecular weight55 kDa including tags
    • Amino acids1 to 473
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab119450 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 85 % SDS-PAGE.
    ab119450 was purified using conventional chromatography. Purity is > 85% by SDS-PAGE.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • Brain Ca(2+) calmodulin dependent protein kinase type 4
    • Brain Ca(2+) calmodulin dependent protein kinase type IV
    • Brain Ca++-calmodulin dependent protein kinase type IV
    • Calcium / calmodulin dependent protein kinase type 4 catalytic chain
    • Calcium / calmodulin dependent protein kinase type IV catalytic chain
    • Calcium/calmodulin dependent protein kinase IV
    • Calcium/calmodulin dependent protein kinase type IV
    • Calcium/calmodulin-dependent protein kinase type IV
    • CAM kinase 4
    • CAM kinase GR
    • CAM kinase IV
    • CAM kinase-GR
    • CaMK 4
    • CAMK GR
    • CaMK IV
    • Camk4
    • CaMKGR
    • IV
    • KCC4_HUMAN
    • MGC36771
    see all
  • FunctionCalcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. May be involved in transcriptional regulation. May be involved in regulation of microtubule dynamics. In vitro, phosphorylates CREB1, CREBBP, PRM2, MEF2A, MEF2D and STMN1/OP18. May be involved in spermatogenesis. May play a role in the consolidation/retention of hippocampus-dependent long-term memory.
  • Tissue specificityExpressed in epithelial ovarian cancer tissue.
  • Sequence similaritiesBelongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated and phosphorylated by CAMKK1 and CAMKK2 (By similarity). Dephosphorylated by serine/threonine protein phosphatase 2A, probably on Thr-200.
  • Cellular localizationCytoplasm. Nucleus. Substantial localization in certain neuronal nuclei. In spermatids associated with chromatin and nuclear matrix.
  • Information by UniProt

Recombinant Human CAMKIV protein images

  • 12% SDS-PAGE showing ab119450 at approximately 54.5kDa (3µg).

References for Recombinant Human CAMKIV protein (ab119450)

ab119450 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab119450.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"