Recombinant Human CAMKK2 protein (ab161090)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGME SFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLS LQERSQGGLAAGGSLDMNGRCICPSLPYSP
    • Amino acids
      1 to 130
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161090 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium/calmodulin dependent protein kinase beta
    • Calcium/calmodulin dependent protein kinase kinase 2
    • Calcium/calmodulin dependent protein kinase kinase 2 beta
    • Calcium/calmodulin dependent protein kinase kinase beta
    • Calcium/calmodulin-dependent protein kinase kinase 2
    • Calcium/calmodulin-dependent protein kinase kinase beta
    • CaM kinase kinase beta
    • CaM KK beta
    • CaM-kinase kinase 2
    • CaM-kinase kinase beta
    • CaM-KK 2
    • CaM-KK beta
    • CAMKK
    • CaMKK 2
    • CaMKK beta
    • CAMKK beta protein
    • Camkk2
    • CAMKKB
    • KKCC2_HUMAN
    see all
  • Function
    Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin-binding domain are inactive. Seems to be involved in hippocampal activation of CREB1.
  • Tissue specificity
    Ubiquitously expressed with higher levels in the brain. Intermediate levels are detected in spleen, prostate, thyroid and leukocytes. The lowest level is in lung.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Domain
    The autoinhibitory domain overlaps with the calmodulin binding region and may be involved in intrasteric autoinhibition.
    The RP domain (arginine/proline-rich) is involved in the recognition of CAMKI and CAMK4 as substrates.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab161090 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161090 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161090.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up