Overview

  • Product name
    Recombinant Human CAMKV protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH TCKKFQKRDGRKVRKAAKNEIGILKMVKHPNILQLVDVFVTRKEYFIFLE LATGREVFDWILDQGYYSERDTSNVVRQVLEAVAYLHSLKIVHRNLKLEN LVYYNRLKNSKIVISDFHLAKLENGLIKEPCGTPEYLAPEVVGRQRYGRP VDCWAIGVIMYILLSGNPPFYEEVEEDDYENHDKNLFRKILAGDYEFDSP YWDDISQAAKDLVTRLMEVEQDQRITAEEAISHEWISGNAASDKNIKDGV CAQIEKNFARAKWKKAVRVTTLMKRLRAPEQSSTAAAQSASATDTATPGA AGGATAAAASGATSAPEGDAARAAKSDNVAPADRSATPATDGSATPATDG SVTPATDGSITPATDGSVTPATDRSATPATDGRATPATEESTVPTTQSSA MLATKAAATPEPAMAQPDSTAPEGATGQAPPSSKGEEAAGCAQESQREEA S
    • Amino acids
      1 to 501
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1G5
    • CaM kinase like vesicle associated
    • CaM kinase like vesicle associated protein
    • CaM kinase-like vesicle-associated protein
    • camkv
    • CAMKV_HUMAN
    • MGC8407
    • OTTHUMP00000212745
    • OTTHUMP00000212766
    • VACAMKL
    • Vesicle associated calmodulin binding protein
    see all
  • Function
    Does not appear to have detectable kinase activity.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Domain
    The protein kinase domain is predicted to be catalytically inactive.
  • Cellular localization
    Cell membrane. Cytoplasmic vesicle membrane. Predominantly observed in association with the plasma membrane of soma and in neurites, both axons and dendrites. May be associated with vesicular structures (By similarity).
  • Information by UniProt

Images

  • ab163956 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163956 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up