Recombinant Human Cannabinoid Receptor I protein (ab114206)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP21554
    • SpeciesHuman
    • SequenceMKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPL TSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGE NFMDIECFMV
    • Molecular weight38 kDa including tags
    • Amino acids1 to 110

Specifications

Our Abpromise guarantee covers the use of ab114206 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CANN6
    • Cannabinoid receptor 1
    • CB-R
    • CB1
    • CB1A
    • CB1K5
    • CB1R
    • Central cannabinoid receptor
    • CNR
    • CNR1
    • CNR1_HUMAN
    • OTTHUMP00000016838
    • OTTHUMP00000214579
    see all
  • FunctionInvolved in cannabinoid-induced CNS effects. Acts by inhibiting adenylate cyclase. Could be a receptor for anandamide. Inhibits L-type Ca(2+) channel current. Isoform 2 and isoform 3 have altered ligand binding.
  • Tissue specificityWidely expressed.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Cannabinoid Receptor I protein images

  • ab114206 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Cannabinoid Receptor I protein (ab114206)

ab114206 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114206.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"