Recombinant Human Cannabinoid Receptor II protein (ab114225)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALE NVAVLYLILSSHQLRRKPSYLFIGS LAGADFLASVVFACSFVNFHVFH GVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRG RA LVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLL FIAFLFSGIIYTYGHVLWKAHQHVASLSG HQDRQVPGMARMRLDVRLA KTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMV NPVIYA LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEA DGKITPWPDSRDLDLSDC
    • Molecular weight
      66 kDa including tags
    • Amino acids
      1 to 360

Specifications

Our Abpromise guarantee covers the use of ab114225 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cannabinoid receptor 2
    • Cannabinoid receptor 2 macrophage
    • CB 2
    • CB-2
    • CB2
    • CNR2
    • CNR2_HUMAN
    • CNRII
    • CX 5
    • CX5
    • hCB2
    • testis-dominant CNR2 isoform CB2
    see all
  • Function
    Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis.
  • Tissue specificity
    Preferentially expressed in cells of the immune system with higher expression in B cells and NK cells (at protein level). Expressed in skin in suprabasal layers and hair follicles (at protein level). Highly expressed in tonsil and to a lower extent in spleen, peripheral blood mononuclear cells, and thymus. PubMed:14657172 could not detect expression in normal brain. Expressed in brain by perivascular microglial cells and dorsal root glanglion sensory neurons (at protein level).
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications
    Constitutively phosphorylated on Ser-352; phosphorylation increases cell internalization and desensitizes the receptor.
  • Cellular localization
    Cell membrane. Cell projection > dendrite. Perikaryon. Localizes to apical dendrite of pyramidal neurons.
  • Information by UniProt

Images

  • ab114225 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114225 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114225.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up