Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      WTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKS KKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDP GRQL
    • Amino acids
      99 to 202
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160626 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6330408P19Rik
    • C terminal PDZ domain ligand of neuronal nitric oxide synthase
    • C terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON)
    • C terminal PDZ ligand of neuronal nitric oxide synthase protein
    • C-terminal PDZ ligand of neuronal nitric oxide synthase protein
    • CAPON
    • CAPON_HUMAN
    • Carboxyl terminal PDZ ligand of neuronal nitric oxide synthase protein
    • Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
    • Ligand of neuronal nitric oxide synthase with carboxyl terminal PDZ domain
    • MGC138500
    • Nitric oxide synthase 1 (neuronal) adaptor protein
    • Nitric oxide synthase 1 adaptor protein
    • Nos1ap
    see all
  • Function
    Adapter protein involved in neuronal nitric-oxide (NO) synthesis regulation via its association with nNOS/NOS1. The complex formed with NOS1 and synapsins is necessary for specific NO and synapsin functions at a presynaptic level. Mediates an indirect interaction between NOS1 and RASD1 leading to enhance the ability of NOS1 to activate RASD1. Competes with DLG4 for interaction with NOS1, possibly affecting NOS1 activity by regulating the interaction between NOS1 and DLG4.
  • Sequence similarities
    Contains 1 PID domain.
  • Information by UniProt

Images

  • ab160626 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160626 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160626.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up