Recombinant Human CAPRIN2 protein (ab163939)

Overview

  • Product name
    Recombinant Human CAPRIN2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTPVDVPVTNPAATILPVHVYPLPQQMRVAFSAARTSNLAPGTLDQPIVF DLLLNNLGETFDLQLGRFNCPVNGTYVFIFHMLKLAVNVPLYVNLMKNEE VLVSAYANDGAPDHETASNHAILQLFQGDQIWLRLHRGAIYGSSWKYSTF SGYLLYQD
    • Amino acids
      1 to 158
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163939 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C1q domain-containing protein 1
    • C1QDC1
    • CAPR2_HUMAN
    • Caprin family member 2
    • Caprin-2
    • caprin2
    • Cytoplasmic activation/proliferation-associated protein 2
    • EEG 1
    • EEG1
    • Gastric cancer multidrug resistance-associated protein
    • KIAA1873
    • Protein EEG-1
    • RNA granule protein 140
    • RNG140
    see all
  • Function
    May regulate the transport and translation of mRNAs, modulating for instance the expression of proteins involved in synaptic plasticity in neurons. Involved in regulation of growth as erythroblasts shift from a highly proliferative state towards their terminal phase of differentiation. May be involved in apoptosis.
  • Tissue specificity
    Detected in all tissues tested with highest levels of expression in brain and spleen.
  • Sequence similarities
    Belongs to the caprin family.
    Contains 1 C1q domain.
  • Developmental stage
    Expression is highly regulated during erythroid development with increased expression at the stage of differentiation associated with the onset of global nuclear condensation and reduced cell proliferation.
  • Cellular localization
    Cytoplasm; Mitochondrion. Colocalizes with aggregated mitochondria and Mitochondrion. Cytoplasm. Expressed throughout the cytoplasm.
  • Information by UniProt

Images

  • ab163939 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163939 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163939.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up