Recombinant Human CAPZA1 protein (ab116884)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP52907
    • SpeciesHuman
    • SequenceLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAY VKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWN
    • Molecular weight35 kDa including tags
    • Amino acids82 to 170

Specifications

Our Abpromise guarantee covers the use of ab116884 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cap Z
    • Cappa 1
    • Cappa1
    • Capping protein (actin filament) muscle Z line alpha 1
    • Capping protein alpha 1
    • Capping protein muscle Z line alpha 1
    • CAPZ
    • CapZ alpha 1
    • CapZ alpha-1
    • CAPZA 1
    • Capza1
    • CAZ 1
    • CAZ1
    • CAZA1_HUMAN
    • F actin capping protein alpha 1 subunit
    • F-actin-capping protein subunit alpha-1
    see all
  • FunctionF-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments.
  • Sequence similaritiesBelongs to the F-actin-capping protein alpha subunit family.
  • Cellular localizationCytoplasm > cytoskeleton.
  • Information by UniProt

Recombinant Human CAPZA1 protein images

  • 12.5% SDS-PAGE showing ab116884 at approximately 35.42kDa stained with Coomassie Blue.

References for Recombinant Human CAPZA1 protein (ab116884)

ab116884 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116884.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"