Recombinant Human CAPZA2 protein (ab158027)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGA AHAFAQYNLDQFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDH LRKEATDPRPCEVENAVESWRTSVETALRAYVKEHYPNGVCTVYGKKIDG QQTIIACIESHQFQAKNFWNGRWRSEWKFTITPSTTQVVGILKIQVHYYE DGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQTAISENYQTM SDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
    • Amino acids
      1 to 286
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158027 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAPPA2
    • Capping protein (actin filament) muscle Z line, alpha 2
    • CAPZ
    • CapZ alpha 2
    • CapZ alpha-2
    • CAPZA2
    • CAZA2_HUMAN
    • F actin capping protein alpha 2 subunit
    • F actin capping protein subunit alpha 2
    • F-actin-capping protein subunit alpha-2
    see all
  • Function
    F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments.
  • Sequence similarities
    Belongs to the F-actin-capping protein alpha subunit family.
  • Information by UniProt

Images

  • ab158027 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158027 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158027.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up