Recombinant Human Carbohydrate sulfotransferase 1 protein (ab152884)

Overview

  • Product name
    Recombinant Human Carbohydrate sulfotransferase 1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PPGPADLVLEEGDCVRKCGLLNLTVAAEACRERSHVAIKTVRVPEVNDLR ALVEDPRLNLKVIQLVRDPRGILASRSETFRDTYRLWRLWYGTGRKPYNL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      168 to 267

Specifications

Our Abpromise guarantee covers the use of ab152884 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carbohydrate chondroitin 6 keratan sulfotransferase 1
    • Carbohydrate chondroitin 6 keratan sulfotransferase
    • Carbohydrate keratan sulfate Gal 6 sulfotransferase
    • Carbohydrate keratan sulfate Gal 6 sulfotransferase 1
    • Carbohydrate sulfotransferase 1
    • Chst1
    • CHST1_HUMAN
    • EC 2.8.2.21
    • Galactose N acetylglucosamine N acetylglucosamine 6 O sulfotransferase 1
    • Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1
    • GST 1
    • GST-1
    • Keratan sulfate Gal 6 sulfotransferase
    • Keratan sulfate Gal-6 sulfotransferase
    • KS6ST
    • KSGal6ST
    • KSST
    see all
  • Function
    Catalyzes the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. Has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer. The sulfotransferase activity on sialyl LacNAc structures is much higher than the corresponding desialylated substrate, and only internal Gal residues are sulfated. May function in the sulfation of sialyl N-acetyllactosamine oligosaccharide chains attached to glycoproteins. Participates in biosynthesis of selectin ligands. Selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation.
  • Tissue specificity
    Widely expressed at low level. Expressed in brain and skeletal muscle. Expressed by high endothelial cells (HEVs) and leukocytes.
  • Sequence similarities
    Belongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152884 stained with Coomassie Blue.

References

ab152884 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152884.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up