Recombinant Human Carbohydrate sulfotransferase 4 protein (ab160854)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQER YLLVRYEDLARAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAF
    • Amino acids
      221 to 320
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160854 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carbohydrate (N acetylglucosamine 6-O) sulfotransferase 4
    • Galactose/N acetylglucosamine/N acetylglucosamine 6 O sulfotransferase 3
    • GlcNAc6ST 2
    • GST 3
    • HEC GLCNAC 6 ST
    • HEC GlcNAc6ST
    • High endothelial cells N acetylglucosamine 6 O sulfotransferase
    • L selectin ligand sulfotransferase
    • LSST
    • N acetylglucosamine 6 O sulfotransferase
    see all
  • Relevance
    Carbohydrate sulfotransferase 4 is a golgi membrane protein that is involved in enzymatic synthesis, in vitro of the disulfated disaccharide unit of corneal keratan sulfate.
  • Cellular localization
    Golgi Apparatus; Golgi membrane; single-pass type II membrane protein.

Images

  • ab160854 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160854 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160854.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up