Recombinant Human Carbonic Anhydrase IX protein (ab114200)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16790
    • SpeciesHuman
    • SequenceMAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLMPVHPQRLPRMQEDSPLG GGSSGEDDPLGEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKP KSEEEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSHWRYGGDPPWP RVSPACAGRFQSPVDIRPQLAAFCPALRPLELLGFQLPPLPELRLRNNGH SVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEI HVVHLSTAFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIA EEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVM LSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRA AEPVQLNSCLAAGDILALVFGLLFAVTSVAFLVQMRRQHRRGTKGGVSYR PAEVAETGA
    • Molecular weight77 kDa including tags
    • Amino acids1 to 459

Specifications

Our Abpromise guarantee covers the use of ab114200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CA-IX
    • CA9
    • CAH9_HUMAN
    • CAIX
    • Carbonate dehydratase IX
    • Carbonic anhydrase 9
    • Carbonic anhydrase IX
    • Carbonic dehydratase
    • G250
    • Membrane antigen MN
    • MN
    • P54/58N
    • pMW1
    • RCC associated protein G250
    • RCC-associated antigen G250
    • Renal cell carcinoma-associated antigen G250
    see all
  • FunctionReversible hydration of carbon dioxide. Participates in pH regulation. May be involved in the control of cell proliferation and transformation. Appears to be a novel specific biomarker for a cervical neoplasia.
  • Tissue specificityExpressed primarily in carcinoma cells lines. Expression is restricted to very few normal tissues and the most abundant expression is found in the epithelial cells of gastric mucosa.
  • Sequence similaritiesBelongs to the alpha-carbonic anhydrase family.
    Contains 1 alpha-carbonic anhydrase domain.
  • Post-translational
    modifications
    Asn-346 bears high-mannose type glycan structures.
  • Cellular localizationNucleus. Nucleus, nucleolus. Cell membrane. Cell projection, microvillus membrane. Found on the surface microvilli and in the nucleus, particularly in nucleolus.
  • Information by UniProt

Recombinant Human Carbonic Anhydrase IX protein images

  • 12.5% SDS-PAGE showing ab114200 at approximately 76.56kDa stained with Coomassie Blue.

References for Recombinant Human Carbonic Anhydrase IX protein (ab114200)

ab114200 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us. Unfortunately we do not have any kit corresponding to the detection of the CAIX protein. However, I would suggest to develop an ELISA assay using the CAIX protein ab114200 that would be coated on the plate. A control ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"