Recombinant Human Carbonic Anhydrase IX protein (ab174050)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QRLPRMQEDSPLGGGSSGEDDPLGEEDLPSEEDSPREEDPPGEEDLPGEE DLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDD QSHWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPLELLGFQL PPLPELRLRNNGHSVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRPGS EHTVEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLEEGPEENS AYEQLLSRLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCA QGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIE ASFPAGVDSSPRAAEPVQLNSCLAAGD
    • Molecular weight
      41 kDa including tags
    • Amino acids
      38 to 414
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Amino acids 38-414 correspond to the Extracellular topological domain of Carbonic Anhydrase IX.

Specifications

Our Abpromise guarantee covers the use of ab174050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C..

    Information available upon request.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 200 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CA-IX
    • CA9
    • CAH9_HUMAN
    • CAIX
    • Carbonate dehydratase IX
    • Carbonic anhydrase 9
    • Carbonic anhydrase IX
    • Carbonic dehydratase
    • G250
    • Membrane antigen MN
    • MN
    • P54/58N
    • pMW1
    • RCC associated protein G250
    • RCC-associated antigen G250
    • Renal cell carcinoma-associated antigen G250
    see all
  • Function
    Reversible hydration of carbon dioxide. Participates in pH regulation. May be involved in the control of cell proliferation and transformation. Appears to be a novel specific biomarker for a cervical neoplasia.
  • Tissue specificity
    Expressed primarily in carcinoma cells lines. Expression is restricted to very few normal tissues and the most abundant expression is found in the epithelial cells of gastric mucosa.
  • Sequence similarities
    Belongs to the alpha-carbonic anhydrase family.
    Contains 1 alpha-carbonic anhydrase domain.
  • Post-translational
    modifications
    Asn-346 bears high-mannose type glycan structures.
  • Cellular localization
    Nucleus. Nucleus, nucleolus. Cell membrane. Cell projection, microvillus membrane. Found on the surface microvilli and in the nucleus, particularly in nucleolus.
  • Information by UniProt

Images

  • The purity of ab174050 was determined by reduced SDS-PAGE and stained overnight with Coomassie Blue.

    Lane 1: MW markers

    Lane 2: DTT-reduced ab174050 (predicted MW 41kDa) migrates as 53-54 kDa due to glycosylation.

References

ab174050 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174050.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up