Recombinant Human Carbonic anhydrase X protein (ab163439)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFW GLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYN TGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQ AFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRML NRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASW IIMNKPVYITRMQMHSLRLLSQNQPSQIF
    • Amino acids
      1 to 279
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163439 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CA 10
    • CA-RP X
    • CA10
    • CAH10_HUMAN
    • Carbonic anhydrase related protein
    • Carbonic anhydrase-related protein 10
    • Carbonic anhydrase-related protein X
    • CARP X
    • CARPX
    • Cerebral protein 15
    • HUCEP 15
    see all
  • Function
    Does not have a catalytic activity.
  • Tissue specificity
    Strong expression in brain and central nervous system.
  • Sequence similarities
    Belongs to the alpha-carbonic anhydrase family.
  • Developmental stage
    Not expressed in fetal brain.
  • Information by UniProt

Images

  • ab163439 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163439 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163439.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up