Recombinant Human Carboxypeptidase B protein (ab152295)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SAHHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQIKP HSTVDFRVKAEDTVTVENVLKQNELQYKVLISNLRNVVEAQFDSRVRATG HSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYLLKVGKAG QNKPAIFMDCGFHAREWISPAFCQWFVREAVRTYGREIQVTELLDKLDFY VLPVLNIDGYIYTWTKSRFWRKTRSTHTGSSCIGTDPNRNFDAGWCEIGA SRNPCDETYCGPAAESEKETKALADFIRNKLSSIKAYLTIHSYSQMMIYP YSYAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAGGSD DWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAIKYVASYVL EHLY
    • Molecular weight
      70 kDa including tags
    • Amino acids
      14 to 417

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152295 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carboxypeptidase B
    • Carboxypeptidase B1
    • Carboxypeptidase B1 (tissue)
    • CarboxypeptidaseB
    • CarboxypeptidaseB1
    • CBPB1_HUMAN
    • CP B1
    • CPB
    • CPB 1
    • CPB1
    • DKFZp779K1333
    • Pancreas specific protein
    • Pancreas-specific protein
    • Pancreatic carboxypeptidase B
    • Pancreatic carboxypeptidase B1
    • PASP
    • PCPB
    • Procarboxypeptidase B
    • Procarboxypeptidase B pancreatic
    • Protaminase
    • Tissue carboxypeptidase B
    see all
  • Tissue specificity
    Pancreas.
  • Sequence similarities
    Belongs to the peptidase M14 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152295 stained with Coomassie Blue.

References

ab152295 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152295.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up