Recombinant Human Carboxypeptidase B2 protein (ab158190)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKLCSLAVLVPIVLFCEQHVFAFQSGQVLAALPRTSRQVQVLQNLTTTYE IVLWQPVTADLIVKKKQVHFFVNASDVDNVKAHLNVSGIPCSVLLADVED LIQQQISNDTVSPRASASYYEQYHSLNEIYSWIEFITERHPDMLTKIHIG SSFEKYPLYVLKVSGKEQAAKNAIWIDCGIHAREWISPAFCLWFIGHITQ FYGIIGQYTNLLRLVDFYVMPVVNVDGYDYSWKKNRMWRKNRSFYANNHC IGTDLNRNFASKHWCEEGASSSSCSETYCGLYPESEPEVKAVASFLRRNI NQIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVASEAVRAIEKTSKN TRYTHGHGSETLYLAPGGGDDWIYDLGIKYSFTIELRDTGTYGFLLPERY IKPTCREAFAAVSKIAWHVIRNV
    • Amino acids
      1 to 423
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1110032P04Rik
    • 4930405E17Rik
    • bA139H14.2
    • Carboxypeptidase B like protein
    • Carboxypeptidase U
    • CarboxypeptidaseB2
    • CarboxypeptidaseU
    • CP B2
    • CPB 2
    • CPB2
    • CPU
    • PCPB
    • Plasma carboxypeptidase B
    • Plasma carboxypeptidase B2
    • Procarboxypeptidase B
    • Procarboxypeptidase R
    • Procarboxypeptidase U
    • TAFI
    • Thrombin activable fibrinolysis inhibitor
    • Thrombin activatable fibrinolysis inhibitor
    see all
  • Relevance
    This protein belongs to a family of Zn-containing metallocarboxypeptidases specific to C-terminal lysine and arginine residues. It circulates in plasma as a zymogen with molecular weight of 55 kDa (401 amino acid residues; pI 5.0). Being activated by thrombin-thrombomodulin complex during blood coagulation, it exerts carboxypeptidase activity. Activated carboxypeptidase B2 removes C-terminal lysine residues from fibrin, which is necessary for plasminogen binding to fibrin. This prevents plasminogen from activation into plasmin and retards the lysis of a fibrin clot. The concentration in plasma of healthy people is 5 – 10 µg/ml. High plasma levels were found in patients with stable angina pectoris and angiographically verified coronary artery disease. Elevated concentration in blood is considered as a risk factor for venous thrombosis. A deficiency might contribute to the severity of bleeding disorders in hemophilias A and B, and decreased levels are found in chronic liver disease.
  • Cellular localization
    Secreted

Images

  • ab158190 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158190 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158190.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up