Recombinant Human Carboxypeptidase H protein (ab116901)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDE TRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPCRKNDDDSSFV DGTTNGGAWYSVPGG
    • Molecular weight
      38 kDa including tags
    • Amino acids
      211 to 325

Specifications

Our Abpromise guarantee covers the use of ab116901 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carboxypeptidase E
    • Carboxypeptidase H
    • Carboxypeptidase H precursor
    • CarboxypeptidaseE
    • CarboxypeptidaseH
    • CBPE_HUMAN
    • Cobalt stimulated chromaffin granule carboxypeptidase
    • CPE
    • CPH
    • Cph 1
    • Enkephalin convertase
    • Entephalin convertase
    • Insulin granule associated carboxypeptidase
    • Prohormone processing carboxypeptidase
    • Prohormone-processing carboxypeptidase
    see all
  • Function
    Removes residual C-terminal Arg or Lys remaining after initial endoprotease cleavage during prohormone processing. Processes proinsulin.
  • Tissue specificity
    Isoform 2, but not isoform 1, is overexpressed in hepatocellular carcinoma (at protein level), as well as in other tumors, including pheochromocytomas and paragangliomas.
  • Sequence similarities
    Belongs to the peptidase M14 family.
  • Cellular localization
    Nucleus and Secreted. Secretory granules of pancreatic islets, adrenal gland, pituitary and brain.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116901 at approximately 38.28 kDa stained with Coomassie Blue.

References

ab116901 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116901.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up