Recombinant Human Carboxypeptidase H protein (ab116901)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDE TRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPCRKNDDDSSFV DGTTNGGAWYSVPGG
    • Molecular weight
      38 kDa including tags
    • Amino acids
      211 to 325

Specifications

Our Abpromise guarantee covers the use of ab116901 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carboxypeptidase E
    • Carboxypeptidase H
    • Carboxypeptidase H precursor
    • CarboxypeptidaseE
    • CarboxypeptidaseH
    • CBPE_HUMAN
    • Cobalt stimulated chromaffin granule carboxypeptidase
    • CPE
    • CPH
    • Cph 1
    • Enkephalin convertase
    • Entephalin convertase
    • Insulin granule associated carboxypeptidase
    • Prohormone processing carboxypeptidase
    • Prohormone-processing carboxypeptidase
    see all
  • Function
    Removes residual C-terminal Arg or Lys remaining after initial endoprotease cleavage during prohormone processing. Processes proinsulin.
  • Tissue specificity
    Isoform 2, but not isoform 1, is overexpressed in hepatocellular carcinoma (at protein level), as well as in other tumors, including pheochromocytomas and paragangliomas.
  • Sequence similarities
    Belongs to the peptidase M14 family.
  • Cellular localization
    Nucleus and Secreted. Secretory granules of pancreatic islets, adrenal gland, pituitary and brain.
  • Information by UniProt

Recombinant Human Carboxypeptidase H protein images

  • 12.5% SDS-PAGE showing ab116901 at approximately 38.28 kDa stained with Coomassie Blue.

References for Recombinant Human Carboxypeptidase H protein (ab116901)

ab116901 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116901.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up