Recombinant human Carboxypeptidase H protein (ab167757)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISR IYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLI FLAQYLCNEYQKGNETIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDW FVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNMKKIVDQNTKL APETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDD AIFQSLARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGG MQDFNYLSSNCFEITVELSCEKFPPEETLKTYWEDNKNSLISYLEQIHRG VKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLIPGNYKLTASA PGYLAITKKVAVPYSPAAGVDFELESFS
    • Molecular weight
      49 kDa including tags
    • Amino acids
      26 to 453
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its ability to cleave a peptide substrate, benzoylAROH. The product, Arg, is reacted with orthophthaldialdehyde (OPA) to form a fluorescent molecule. The specific activity is > 12000 pmoles/min/µg.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab167757 is lyophilized from 0.22 µm filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 94% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water. Solubilise for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Carboxypeptidase E
    • Carboxypeptidase H
    • Carboxypeptidase H precursor
    • CarboxypeptidaseE
    • CarboxypeptidaseH
    • CBPE_HUMAN
    • Cobalt stimulated chromaffin granule carboxypeptidase
    • CPE
    • CPH
    • Cph 1
    • Enkephalin convertase
    • Entephalin convertase
    • Insulin granule associated carboxypeptidase
    • Prohormone processing carboxypeptidase
    • Prohormone-processing carboxypeptidase
    see all
  • Function
    Removes residual C-terminal Arg or Lys remaining after initial endoprotease cleavage during prohormone processing. Processes proinsulin.
  • Tissue specificity
    Isoform 2, but not isoform 1, is overexpressed in hepatocellular carcinoma (at protein level), as well as in other tumors, including pheochromocytomas and paragangliomas.
  • Sequence similarities
    Belongs to the peptidase M14 family.
  • Cellular localization
    Nucleus and Secreted. Secretory granules of pancreatic islets, adrenal gland, pituitary and brain.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab167757 stained overnight with Coomassie Blue.

References

ab167757 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up