Recombinant Human Carboxypeptidase M protein (ab114870)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP14384
    • SpeciesHuman
    • SequenceGVTNGYSWYPLQGGMQDYNYIWAQCFEITLELSCCKYPREEKLPSFWNNN KASLIEYIKQVHLGVKGQVFDQNGNPLPNVIVEVQDRKHICPYRTNKYG
    • Molecular weight37 kDa including tags
    • Amino acids251 to 349

Specifications

Our Abpromise guarantee covers the use of ab114870 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carboxypeptidase M
    • CBPM_HUMAN
    • CPM
    • Renal carboxypeptidase
    • Urinary carboxypeptidase B
    see all
  • FunctionSpecifically removes C-terminal basic residues (Arg or Lys) from peptides and proteins. It is believed to play important roles in the control of peptide hormone and growth factor activity at the cell surface, and in the membrane-localized degradation of extracellular proteins.
  • Sequence similaritiesBelongs to the peptidase M14 family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Carboxypeptidase M protein images

  • 12.5% SDS-PAGE showing ab114870 at approximately 36.52kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Carboxypeptidase M protein (ab114870)

ab114870 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114870.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"