Recombinant Human Casein Kinase 1 alpha protein (ab152301)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQ KARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDL FNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHC NKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSR RDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCK GFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM LKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
    • Molecular weight
      65 kDa including tags
    • Amino acids
      1 to 337

Specifications

Our Abpromise guarantee covers the use of ab152301 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Casein kinase 1 alpha 1
    • Casein kinase I isoform alpha
    • CK1
    • CK1A
    • CKI alpha
    • CKI-alpha
    • CKIa
    • Clock regulator kinase
    • Csnk1a1
    • Down regulated in lung cancer
    • HLCDGP1
    • KC1A_HUMAN
    • PRO2975
    see all
  • Function
    Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May play a role in segregating chromosomes during mitosis.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. Casein kinase I subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton > centrosome. Chromosome > centromere > kinetochore. Nucleus speckle. Localizes to the centrosome in interphase cells, and to kinetochore fibers during mitosis.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152301 stained with Coomassie Blue.

References

ab152301 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152301.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up