Recombinant Human Caspase-1 protein (ab158029)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQR IWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLL QNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGI CGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVV WFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHP TMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVT LTRCFYLFPGH
    • Amino acids
      1 to 311
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CASP-1
    • CASP1
    • CASP1_HUMAN
    • Caspase 1
    • Caspase-1 subunit p10
    • ICE
    • IL-1 beta-converting enzyme
    • IL-1BC
    • IL1 beta converting enzyme
    • IL1B convertase
    • Interleukin 1 beta convertase
    • Interleukin 1B converting enzyme
    • Interleukin-1 beta convertase
    • Interleukin-1 beta-converting enzyme
    • p45
    see all
  • Function
    Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis.
  • Tissue specificity
    Expressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain.
  • Sequence similarities
    Belongs to the peptidase C14A family.
    Contains 1 CARD domain.
  • Post-translational
    modifications
    The two subunits are derived from the precursor sequence by an autocatalytic mechanism.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab158029 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158029 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158029.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up