Recombinant human Caspase-9 protein (Tagged) (ab198061)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGS RRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSK PTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVGALESLRGNAD LAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFM VEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAV YGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS TSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPG FVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQM PGCFNFLRKKLFFKTSHHHHHH
    • Amino acids
      1 to 416
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Procaspase- 9 is autocleaved between the prodomain and large protease subunit (p35). The cleavage product, contains both the large (p35) and small (p10 [His-tag]) protease subunits. MWt: 35 & 10 kDa

Specifications

Our Abpromise guarantee covers the use of ab198061 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: 0.11 pmol/min/μg.

    Assay conditions: 50 mM HEPES, pH 7.2, 50 mM NaCl, 10 mM EDTA, 0.1% Chaps, 5% glycerol, 10 mM DTT, and 10 μM Caspase 9 substrate. Incubate for 30 minutes at room temperature. Fluorescence intensity is measured at exc380/em505 nm.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >= 56 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 0.54% Imidazole
    Constituents: 0.05% DTT, 20% Glycerol, 0.02% Potassium chloride, 0.64% Sodium chloride, 0.61% Tris

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • APAF-3
    • APAF3
    • Apoptosis related cysteine peptidase
    • Apoptotic protease Mch-6
    • Apoptotic protease-activating factor 3
    • CASP-9
    • CASP9
    • CASP9_HUMAN
    • Caspase 9 apoptosis related cysteine peptidase
    • Caspase 9 Dominant Negative
    • Caspase 9c
    • Caspase-9
    • Caspase-9 subunit p10
    • ICE LAP6
    • ICE like apoptotic protease 6
    • ICE-LAP6
    • ICE-like apoptotic protease 6
    • MCH6
    • PPP1R56
    • protein phosphatase 1, regulatory subunit 56
    • RNCASP9
    see all
  • Function
    Involved in the activation cascade of caspases responsible for apoptosis execution. Binding of caspase-9 to Apaf-1 leads to activation of the protease which then cleaves and activates caspase-3. Proteolytically cleaves poly(ADP-ribose) polymerase (PARP).
    Isoform 2 lacks activity is an dominant-negative inhibitor of caspase-9.
  • Tissue specificity
    Ubiquitous, with highest expression in the heart, moderate expression in liver, skeletal muscle, and pancreas. Low levels in all other tissues. Within the heart, specifically expressed in myocytes.
  • Sequence similarities
    Belongs to the peptidase C14A family.
    Contains 1 CARD domain.
  • Developmental stage
    Expressed at low levels in fetal heart, at moderate levels in neonate heart, and at high levels in adult heart.
  • Post-translational
    modifications
    Cleavages at Asp-315 by granzyme B and at Asp-330 by caspase-3 generate the two active subunits. Caspase-8 and -10 can also be involved in these processing events.
  • Information by UniProt

Images

  • Activity assay using ab198122.

  • 4-20% SDS-PAGE analysis of 2.5 µg ab198061 with Coomassie staining.

References

ab198061 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198061.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up