Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTI LSPKNMEPSKIS
    • Molecular weight
      32 kDa including tags
    • Amino acids
      431 to 492

Specifications

Our Abpromise guarantee covers the use of ab114730 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Amino acid transporter cationic 1
    • ATRC1
    • CAT-1
    • CaT1
    • CTR1_HUMAN
    • Ecotropic retroviral leukemia receptor homolog
    • Ecotropic retroviral receptor
    • Ecotropic retrovirus receptor homolog
    • ERR
    • HCAT1
    • High affinity cationic amino acid transporter 1
    • High-affinity cationic amino acid transporter-1
    • REC1L
    • Slc7a1
    • Solute carrier family 7 (cationic amino acid transporter, y+ system) member 1
    • Solute carrier family 7 member 1
    • System Y+ basic amino acid transporter
    see all
  • Function
    High-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. May also function as an ecotropic retroviral leukemia receptor.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the amino acid-polyamine-organocation (APC) superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human CAT1 protein images

  • 12.5% SDS-PAGE showing ab114730 at approximately 32.45kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CAT1 protein (ab114730)

ab114730 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114730.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up