Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTI LSPKNMEPSKIS
    • Molecular weight
      32 kDa including tags
    • Amino acids
      431 to 492

Specifications

Our Abpromise guarantee covers the use of ab114730 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Amino acid transporter cationic 1
    • ATRC1
    • CAT-1
    • CaT1
    • CTR1_HUMAN
    • Ecotropic retroviral leukemia receptor homolog
    • Ecotropic retroviral receptor
    • Ecotropic retrovirus receptor homolog
    • ERR
    • HCAT1
    • High affinity cationic amino acid transporter 1
    • High-affinity cationic amino acid transporter-1
    • REC1L
    • Slc7a1
    • Solute carrier family 7 (cationic amino acid transporter, y+ system) member 1
    • Solute carrier family 7 member 1
    • System Y+ basic amino acid transporter
    see all
  • Function
    High-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. May also function as an ecotropic retroviral leukemia receptor.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the amino acid-polyamine-organocation (APC) superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114730 at approximately 32.45kDa.
    Stained with Coomassie Blue.

References

ab114730 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114730.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up