Recombinant Human Cathepsin E protein (ab114806)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP14091
    • SpeciesHuman
    • SequenceQGSLHRVPLRRHPTLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAK EPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTH SRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGE SVTEPGQTLVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSV YMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGG TVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANL NVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPL WILGDVFIRQFYSVFDRGNNRVGLAPAVP
    • Molecular weight68 kDa including tags
    • Amino acids18 to 396

Specifications

Our Abpromise guarantee covers the use of ab114806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CATE
    • CATE_HUMAN
    • Cathepsin E
    • Cathepsin E form II
    • CTSE
    • Erythrocyte membrane aspartic proteinase
    • Slow moving proteinase
    see all
  • FunctionMay have a role in immune function. Probably involved in the processing of antigenic peptides during MHC class II-mediated antigen presentation. May play a role in activation-induced lymphocyte depletion in the thymus, and in neuronal degeneration and glial cell activation in the brain.
  • Tissue specificityExpressed abundantly in the stomach, the Clara cells of the lung and activated B-lymphocytes, and at lower levels in lymph nodes, skin and spleen. Not expressed in resting B-lymphocytes.
  • Sequence similaritiesBelongs to the peptidase A1 family.
  • Post-translational
    modifications
    Glycosylated. The nature of the carbohydrate chain varies between cell types. In fibroblasts, the proenzyme contains a high mannose-type oligosaccharide, while the mature enzyme contains a complex-type oligosaccharide. In erythrocyte membranes, both the proenzyme and mature enzyme contain a complex-type oligosaccharide.
    Two forms are produced by autocatalytic cleavage, form I begins at Ile-54, form II begins at Thr-57.
  • Cellular localizationEndosome. The proenzyme is localized to the endoplasmic reticulum and Golgi apparatus, while the mature enzyme is localized to the endosome.
  • Information by UniProt

Recombinant Human Cathepsin E protein images

  • ab114806 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human Cathepsin E protein (ab114806)

ab114806 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"