Recombinant Human Cathepsin L protein (ab151930)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNVKMIELHNQEYR EGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRS VDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLV DCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKY SVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEP DCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKD RRNHCGIASAASYPTVVDHHHHHH
    • Molecular weight
      37 kDa including tags
    • Amino acids
      18 to 333
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
    ab151930 was 0.2 µM filtered.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 4.50
    Constituents: Sodium Acetate Buffer, 0.88% Sodium chloride

General Info

  • Alternative names
    • cathepsin L, 1 b
    • Cathepsin L1
    • Cathepsin L1 light chain
    • CathepsinL
    • CATL
    • CATL1_HUMAN
    • cb15
    • CTSL
    • CTSL1
    • ctsl1b
    • FLJ31037
    • hgg1
    • Major excreted protein
    • MEP
    • MGC123162
    • wu:fb30g09
    see all
  • Function
    Important for the overall degradation of proteins in lysosomes.
  • Sequence similarities
    Belongs to the peptidase C1 family.
  • Cellular localization
    Lysosome.
  • Information by UniProt

References

ab151930 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151930.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up