Recombinant Human Cathepsin S protein (ab152085)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEH SMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNWILP DSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQN LVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYD SKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGV YYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNK GNHCGIASFPSYPEIVDHHHHHH
    • Molecular weight
      37 kDa including tags
    • Amino acids
      17 to 331
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 5.50
    Constituents: 0.39% MES, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • Cathepsin S
    • CathepsinS
    • CATS_HUMAN
    • Ctss
  • Function
    Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.
  • Sequence similarities
    Belongs to the peptidase C1 family.
  • Cellular localization
    Lysosome.
  • Information by UniProt

References

ab152085 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up