Recombinant Human Cathepsin V protein (ab152308)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNLSLVLAAFCLGIASAVPKFDQNLDTKWYQWKATHRRLYGANEEGWRRA VWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKF RKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQ MFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEE SYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAM DAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVK NSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV
    • Molecular weight
      64 kDa including tags
    • Amino acids
      1 to 334

Specifications

Our Abpromise guarantee covers the use of ab152308 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAT L2
    • Cathepsin L2
    • Cathepsin U
    • Cathepsin V
    • CathepsinL2
    • CathepsinU
    • CathepsinV
    • CATL 2
    • CATL2
    • CATL2_HUMAN
    • CTS L2
    • CTS U
    • CTS V
    • CTSL 2
    • CTSL2
    • CTSU
    • CTSV
    • MGC125957
    • PRO305
    • UNQ268
    see all
  • Function
    Cysteine protease. May have an important role in corneal physiology.
  • Tissue specificity
    Predominantly expressed in the thymus and testis. Also expressed in corneal epithelium, and to a lesser extent in conjunctival epithelium and skin.
  • Sequence similarities
    Belongs to the peptidase C1 family.
  • Cellular localization
    Lysosome.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152308 stained with Coomassie Blue.

References

ab152308 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152308.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up