Recombinant Human Cathepsin Z protein (ab114908)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTY PRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSA MADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIP DETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGRE KMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGI SDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGD PIV
    • Molecular weight
      59 kDa including tags
    • Amino acids
      1 to 303

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114908 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carboxypeptidase LB
    • Cathepsin B2
    • Cathepsin IV
    • Cathepsin P
    • Cathepsin X
    • Cathepsin X precursor
    • Cathepsin Y
    • Cathepsin Z
    • Cathepsin Z precursor
    • Cathepsin Z1
    • CathepsinP
    • CathepsinX
    • CathepsinZ
    • CATZ_HUMAN
    • CTSX
    • CTSZ
    • Cysteine type carboxypeptidase
    • FLJ17088
    • Lysosomal carboxypeptidase B
    • Preprocathepsin P
    • PreprocathepsinP
    see all
  • Function
    Exhibits carboxy-monopeptidase as well as carboxy-dipeptidase activity.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the peptidase C1 family.
  • Cellular localization
    Lysosome.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114908 at approximately 59.40kDa.
    Stained with Coomassie Blue.

References

ab114908 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114908.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up