Recombinant Human CATSPER1 protein (ab165120)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDQNSVPEKAQNEADTNNADRFFRSHSSPPHHRPGHSRALHHYELHHHGV PHQRGESHHPPEFQDFHDQALSSHVHQSHHHSEARNHGRAHGPTGFGLAP SQGAVPSHRSYGEDYHDELQRDGRRHHDGSQYGGFHQQSDSHYHRGSHHG RPQYLGENLSHYSSGVPHHGEASHHGGSYLPHGPNPYSESFHHSEASHLS GLQHDESQHHQVPHRGWPHHHQVHHHGRSRHHEAHQHGKSPHHGETISPH SSVGSYQRGISDYHSEYHQGDHHPSEYHHGDHPHHTQHHYHQTHRHRDYH QHQDHHGAYHSSYLHGDYVQSTSQLSIPHTSRSLIHDAPGPAASRTGVFP YHVAHPRGSAHSMTRSSSTIRSRVTQMSKKVHTQDISTKHSEDWGKEEGQ FQKRKTGRLQRTRKKGHSTNLFQWLWEKLTFLIQGFREMIRNLTQSLAFE TFIFFVVCLNTVMLVAQTFAEVEIRGEWYFMALDSIFFCIYVVEALLKII ALGLSYFFDFWNNLDFFIMAMAVLDFLLMQTHSFAIYHQSLFRILKVFKS LRALRAIRVLRRLSFLTSVQEVTGTLGQSLPSIAAILILMFTCLFLFSAV LRALFRKSDPKRFQNIFTTIFTLFTLLTLDDWSLIYMDSRAQGAWYIIPI LIIYIIIQYFIFLNLVITVLVDSFQTALFKGLEKAKQERAARIQEKLLED SLTELRAAEPKEVASEGTMLKRLIEKKFGTMTEKQQELLFHYLQLVASVE QEQQKFRSQAAVIDEIVDTTFEAGEEDFRN
    • Amino acids
      1 to 780
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165120 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cation channel sperm associated 1
    • Cation channel sperm associated protein 1
    • Cation channel sperm-associated protein 1
    • CATSPER
    • CATSPER 1
    • CatSper1
    • CTSR1_HUMAN
    • hCatSper
    • MGC33335
    • MGC33368
    • Sperm associated cation channel 1
    • Sperm ion channel
    see all
  • Function
    Voltage-gated calcium channel that plays a central role in calcium-dependent physiological responses essential for successful fertilization, such as sperm hyperactivation, acrosome reaction and chemotaxis towards the oocyte. Activated by extracellular progesterone and prostaglandins following the sequence: progesterone > PGF1-alpha = PGE1 > PGA1 > PGE2 >> PGD2. The primary effect of progesterone activation is to shift voltage dependence towards more physiological, negative membrane potentials; it is not mediated by metabotropic receptors and second messengers. Sperm capacitation enhances the effect of progesterone by providing additional negative shift. Also activated by the elevation of intracellular pH.
  • Tissue specificity
    Testis-specific.
  • Involvement in disease
    Defects in CATSPER1 are the cause of spermatogenic failure type 7 (SPGF7) [MIM:612997]. An infertility disorder characterized by non-motile sperm or sperm motility below the normal threshold, low sperm count, increased abnormally structured spermatozoa, and reduced semen volume.
  • Sequence similarities
    Belongs to the cation channel sperm-associated (TC 1.A.1.19) family.
  • Developmental stage
    Expressed meiotically and post-meiotically.
  • Cellular localization
    Cell projection > cilium > flagellum membrane. Specifically located in the principal piece of sperm tail.
  • Information by UniProt

Images

  • ab165120 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165120 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165120.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up