Recombinant Human Caveolin-1 protein (ab114170)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ03135
    • SpeciesHuman
    • SequenceMSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID LVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFY RLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSI YVHTVCDPLFEAVGKIFSNVRINLQKEI
    • Molecular weight46 kDa including tags
    • Amino acids1 to 178
    • Additional sequence informationThere is a GST tag at N-terminal end.

Specifications

Our Abpromise guarantee covers the use of ab114170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BSCL3
    • CAV
    • CAV1
    • CAV1_HUMAN
    • caveolae protein, 22 kD
    • caveolin 1 alpha isoform
    • caveolin 1 beta isoform
    • Caveolin 1 caveolae protein 22kDa
    • Caveolin-1
    • Caveolin1
    • cell growth-inhibiting protein 32
    • CGL3
    • LCCNS
    • MSTP085
    • OTTHUMP00000025031
    • PPH3
    • VIP 21
    • VIP21
    see all
  • FunctionMay act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway.
  • Tissue specificityExpressed in muscle and lung, less so in liver, brain and kidney.
  • Involvement in diseaseDefects in CAV1 are the cause of congenital generalized lipodystrophy type 3 (CGL3) [MIM:612526]; also called Berardinelli-Seip congenital lipodystrophy type 3 (BSCL3). Congenital generalized lipodystrophies are autosomal recessive disorders characterized by a near absence of adipose tissue, extreme insulin resistance, hypertriglyceridemia, hepatic steatosis and early onset of diabetes.
  • Sequence similaritiesBelongs to the caveolin family.
  • Post-translational
    modifications
    The initiator methionine for isoform Beta is removed during or just after translation. The new N-terminal amino acid is then N-acetylated.
  • Cellular localizationGolgi apparatus membrane. Cell membrane. Membrane > caveola. Membrane raft. Colocalized with DPP4 in membrane rafts. Potential hairpin-like structure in the membrane. Membrane protein of caveolae.
  • Information by UniProt

Recombinant Human Caveolin-1 protein images

  • ab114170 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

  • Developed using the ECL technique

    Performed under reducing conditions.
    Ab18199 recognizes the full length tagged recombinant Caveolin 1 protein (ab114170) which has an expected molecular weight of 46 kDa.

References for Recombinant Human Caveolin-1 protein (ab114170)

ab114170 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"