Recombinant Human CBARA1 protein (ab153073)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFRLNSLSALAELAVGSRWYHGGSQPIQIRRRLMMVAFLGASAVTASTGL LWKRAHAESPPCVDNLKSDIGDKGKNKDEGDVCNHEKKTADLAPHPEEKK KKRSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVISEPGEAEVFMTPE DFVRSITPNEKQPEHLGLDQYIIKRFDGKKISQEREKFADEGSIFYTLGE CGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSII RSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQ RKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLK KHFKEGKGLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVA RTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKD MGFTRLMQAMWKCAQETAWDFALPKQ
    • Amino acids
      1 to 476
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153073 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Allergen Hom s 4
    • ara CALC
    • atopy related autoantigen
    • atopy related autoantigen CALC
    • Atopy-related autoantigen CALC
    • CALC
    • calcium binding atopy related autoantigen 1
    • Calcium uptake protein 1
    • calcium uptake protein 1, mitochondrial
    • Calcium-binding atopy-related autoantigen 1
    • CBARA1
    • EFHA3
    • FLJ12684
    • MICU1
    • MICU1_HUMAN
    • mitochondrial
    • mitochondrial calcium uptake 1
    • MPXPS
    see all
  • Function
    Key regulator of mitochondrial calcium uptake required for calcium entry into mitochondrion. May act as a calcium sensor via its EF-hand domains, gating the activity of a calcium channel partner. Induces T-helper 1-mediated autoreactivity, which is accompanied by the release of IFNG.
  • Tissue specificity
    Expressed in epithelial cell line. Strongly expressed in epidermal keratinocytes and dermal endothelial cells.
  • Sequence similarities
    Belongs to the MICU1 family.
    Contains 2 EF-hand domains.
  • Domain
    The EF-hand domains are required for mitochondrial calcium homeostasis function.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab153073 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153073 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153073.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up