Recombinant Human CBFA2T3 protein (ab152257)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPASRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGP APVDRKAKASAMPDSPAEVKTQPRSTPPSMPPPPPAASQGATRPPSFTPH TLMNGSSHSPTAINGAPCTPNGFSNGPATSSTASLSTQHLPPACGARQLS KLKRFLTTLQQFGSDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATN FPLRPFVIPFLKANLPLLQRELLHCARLAKQTPAQYLAQHEQLLLDASAS SPIDSSELLLEVNENGKRRTPDRTKENGSDRDPLHPQRYSPSNGPPQPTP PPHYRLEDIAMAHHFRDAYRHPDPRELRERHRPLVVPGSRQEEVIDHKLT EREWAEEWKHLNNLLNCIMDMVEKTRRSLTVLRRCQEADREELNHWARRY SDAEDTKKGPAPAAARPRSSSAGPEGPQLDVPREFLPRTLTGYVPEDIWR KAEEAVNEVKRQAMSELQKAVSDAERKAHELITTERAKMERALAEAKRQA SEDALTVINQQEDSSESCWNCGRKASETCSGCNAARYCGSFCQHRDWEKH HHVCGQSLQGPTAVVADPVPGPPEAAHSLGPSLPVGAASPSEAGSAGPSR PGSPSPPGPLDTVPR
    • Molecular weight
      93 kDa including tags
    • Amino acids
      1 to 615

Specifications

Our Abpromise guarantee covers the use of ab152257 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cbfa2t3
    • Ccore binding factor runt domain alpha subunit 2 translocated to 3
    • ETO2
    • hMTG16
    • hMTG16a
    • hMTG16b
    • MTG16
    • MTG16_HUMAN
    • MTG8 related gene 2
    • MTG8 related protein MTG16a
    • MTG8 related protein MTG16b
    • MTG8-related protein 2
    • MTGR2
    • Myeloid translocation gene 8 and 16b
    • Myeloid translocation gene on chromosome 16 protein
    • Protein CBFA2T3
    • Zinc finger MYND domain-containing protein 4
    • ZMYND4
    see all
  • Function
    Functions as a transcriptional repressor. Regulates the proliferation and the differentiation of erythroid progenitors by repressing the expression of TAL1 target genes. Plays a role in granulocyte differentiation.
    Isoform 2 functions as an A-kinase-anchoring protein.
  • Tissue specificity
    Widely expressed with higher expression in heart, pancreas, skeletal muscle, spleen, thymus and peripheral blood leukocytes. Expressed in hematopoietic cells (at protein level).
  • Involvement in disease
    Note=A chromosomal aberration involving CBFA2T3 is found in therapy-related myeloid malignancies. Translocation t(16;21)(q24;q22) that forms a RUNX1-CBFA2T3 fusion protein.
  • Sequence similarities
    Belongs to the CBFA2T family.
    Contains 1 MYND-type zinc finger.
    Contains 1 TAFH (NHR1) domain.
  • Cellular localization
    Nucleus > nucleolus. The RUNX1-CBFA2T3 fusion protein localizes to the nucleoplasm and Nucleus > nucleoplasm. Golgi apparatus membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152257 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152257.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up