Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ13951
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMPRVVPDQRSKFENEEFFRKLSRECEIKYT GFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQT PSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEE RAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTT RP
    • Molecular weight24 kDa including tags
    • Amino acids1 to 182
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98252 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity>= 85 % SDS-PAGE.
    ab98252 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM MES, 0.1mM PMSF, pH 6.0

General Info

  • Alternative names
    • CBF b
    • CBF beta
    • CBF-beta
    • CBFB
    • CBFbeta
    • Core binding factor beta subunit
    • core binding factor subunit beta
    • Core-binding factor subunit beta
    • PEA 2
    • PEA2
    • PEA2 beta
    • PEA2-beta
    • PEA2beta
    • PEBB_HUMAN
    • PEBP 2B
    • PEBP2 beta
    • PEBP2-beta
    • PEBP2B
    • PEBP2beta
    • Polyomavirus enhancer binding protein 2 beta subunit
    • Polyomavirus enhancer-binding protein 2 beta subunit
    • SL3 3 enhancer factor 1 beta subunit
    • SL3 3 enhancer factor 1 subunit beta
    • SL3-3 enhancer factor 1 subunit beta
    • SL3/AKV core binding factor beta subunit
    • SL3/AKV core-binding factor beta subunit
    see all
  • FunctionCBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters. CBFB enhances DNA binding by RUNX1.
  • Involvement in diseaseNote=A chromosomal aberration involving CBFB is associated with acute myeloid leukemia of M4EO subtype. Pericentric inversion inv(16)(p13;q22). The inversion produces a fusion protein that consists of the 165 N-terminal residues of CBF-beta (PEPB2) with the tail region of MYH11.
  • Sequence similaritiesBelongs to the CBF-beta family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human CBFb protein images

  • 15% SDS-PAGE analysis of 3µg ab98252

References for Recombinant Human CBFb protein (ab98252)

ab98252 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98252.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"