Overview

  • Product name
    Recombinant Human Cbl-c protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALAVAPWGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPR TAQLLREVAHSRRAAGGGGPGGPGGSGDFLLIYLANLEAKSRQVAALLPP RGRRSANDELFRAGSRLRRQLAKLAIIFSHMHAELHALFPGGKYCGHMYQ LTKAPAHTFWRESCGARCVLPWAEFESLLGTCHPVEPGCTALALRTTIDL TCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMAFLTYDEVQER LQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLE GQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFEL CKICAESNKDVKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVS IYQFHGQATAEDPGNSSDQEGRELELGQVPLSAPPLPPRPDLPPRKPRNA QPKVRLLKGNSPPAALGPQDPAPA
    • Amino acids
      1 to 474
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cas Br M (murine) ecotropic retroviral transforming sequence c
    • Cas Br M (murine) ectropic retroviral transforming sequence c
    • Casitas B lineage lymphoma c
    • CBL 3
    • Cbl proto-oncogene C, E3 ubiquitin protein ligase
    • Cbl proto-oncogene, E3 ubiquitin protein ligase C
    • CBL SL
    • E3 ubiquitin-protein ligase CBL-C
    • RING finger protein 57
    • RNF57
    • SH3 binding protein CBL C
    • SH3-binding protein CBL-3
    • Signal transduction protein CBL C
    see all
  • Relevance
    Cblc belongs to a family of ubiquitin protein ligases (E3s) that negatively regulate signaling by targeting activated tyrosine kinases for degradation. Cblc is the most recently cloned member of the Cbl proteins and is expressed only in epithelial cells (the other Cbl proteins are ubiquitous). Cblc, like the other mammalian Cbl proteins, can ubiquitinate the activated EGFR and target it for degradation. Cblc knock out mice show no obvious phenotype. Thus, the physiological role of Cblc is not known.
  • Cellular localization
    Nuclear

Images

  • ab161722 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161722 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161722.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up