Overview

  • Product name
    Recombinant Human CBLL1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINR MPAKAPPGDEEGFDYNEEERYDCKGGELFANQRRFPGHLFWDFQINILGE
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153514 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • c-Cbl-like protein 1
    • CasBrM (murine) ecotropic retroviral transforming sequencelike 1
    • Casitas B-lineage lymphoma transforming sequence-like protein 1
    • Casitas B-lineage lymphoma-like 1
    • Casitas B-lineage lymphoma-transforming sequence-like protein 1
    • cbll1
    • E3 ubiquitin-protein ligase Hakai
    • Ecadherin binding protein E7
    • FLJ23109
    • HAKAI
    • HAKAI_HUMAN
    • MGC163401
    • MGC163403
    • OTTHUMP00000206720
    • OTTHUMP00000206722
    • OTTHUMP00000206724
    • RING finger protein 188
    • RNF188
    see all
  • Function
    Promotes ubiquitination of tyrosine-phosphorylated CDH1, thus targeting CDH1 for endocytosis and degradation.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 C2H2-type zinc finger.
    Contains 1 RING-type zinc finger.
  • Information by UniProt

Images

  • ab153514 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153514 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153514.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up