Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP16152
    • SpeciesHuman
    • SequenceMSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQL QAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADP TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSC SPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIG VTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAET PVYLALLPPDAEGPHGQFVSEKRVEQW
    • Molecular weight30 kDa
    • Amino acids1 to 277

Specifications

Our Abpromise guarantee covers the use of ab117172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab117172 is purified by proprietary chromatographic techniques.
  • FormLiquid
  • Additional notesStore at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.50
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • 15 hydroxyprostaglandin dehydrogenase [NADP+]
    • 15-hydroxyprostaglandin dehydrogenase [NADP+]
    • Carbonyl reductase [NADPH] 1
    • Carbonyl Reductase 1
    • CBR 1
    • CBR1
    • CBR1_HUMAN
    • CRN
    • NADPH dependent carbonyl reductase 1
    • NADPH-dependent carbonyl reductase 1
    • Prostaglandin 9 ketoreductase
    • Prostaglandin 9-ketoreductase
    • Prostaglandin E(2) 9 reductase
    • Prostaglandin-E(2) 9-reductase
    • SDR21C1
    see all
  • FunctionNADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.
  • Sequence similaritiesBelongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

References for Recombinant Human CBR1 protein (ab117172)

ab117172 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117172.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"