Recombinant Human CBX1 / HP1 beta protein (ab109847)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGKKQNKKKVEEVLEEEEEEYVVEKVLDRR VVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKS EGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSG ELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDK KDDKN
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 185
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab109847 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.316% Tris HCl, 0.058% Sodium chloride, 0.0308% DTT, pH 8.0

General Info

  • Alternative names
    • CBX
    • CBX 1
    • Cbx1
    • CBX1_HUMAN
    • Chromobox 1
    • chromobox homolog 1
    • Chromobox homolog 1 (HP1 beta homolog Drosophila )
    • Chromobox protein homolog 1
    • Drosophila HP1 beta
    • Heterochromatin protein 1 beta
    • Heterochromatin protein 1 homolog beta
    • Heterochromatin protein p25
    • heterochromatin protein p25 beta
    • HP1 beta
    • HP1 beta homolog
    • HP1 beta homolog Drosophila
    • HP1, Drosophila. homolog of, beta
    • HP1beta
    • HP1Hs beta
    • HP1Hsbeta
    • Human heterochromatin protein p25 mRNA complete cds
    • M31
    • MOD 1
    • MOD1
    • Modifier 1 protein
    • p25beta
    see all
  • Function
    Component of heterochromatin. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. Interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the inner nuclear membrane.
  • Tissue specificity
    Expressed in all adult and embryonic tissues.
  • Sequence similarities
    Contains 2 chromo domains.
  • Post-translational
    modifications
    Not phosphorylated.
    Ubiquitinated.
  • Cellular localization
    Nucleus. Unassociated with chromosomes during mitosis.
  • Information by UniProt

Recombinant Human CBX1 / HP1 beta protein images

  • 15% SDS-PAGE showing ab109847 at approximately 23.6 kDa (3µg).

References for Recombinant Human CBX1 / HP1 beta protein (ab109847)

ab109847 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up