Recombinant Human CBX1 / HP1 beta protein (ab109847)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP83916
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGKKQNKKKVEEVLEEEEEEYVVEKVLDRR VVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKS EGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSG ELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDK KDDKN
    • Molecular weight24 kDa including tags
    • Amino acids1 to 185
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab109847 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.316% Tris HCl, 0.058% Sodium chloride, 0.0308% DTT, pH 8.0

General Info

  • Alternative names
    • CBX
    • CBX 1
    • Cbx1
    • CBX1_HUMAN
    • Chromobox 1
    • chromobox homolog 1
    • Chromobox homolog 1 (HP1 beta homolog Drosophila )
    • Chromobox protein homolog 1
    • Drosophila HP1 beta
    • Heterochromatin protein 1 beta
    • Heterochromatin protein 1 homolog beta
    • Heterochromatin protein p25
    • heterochromatin protein p25 beta
    • HP1 beta
    • HP1 beta homolog
    • HP1 beta homolog Drosophila
    • HP1, Drosophila. homolog of, beta
    • HP1beta
    • HP1Hs beta
    • HP1Hsbeta
    • Human heterochromatin protein p25 mRNA complete cds
    • M31
    • MOD 1
    • MOD1
    • Modifier 1 protein
    • p25beta
    see all
  • FunctionComponent of heterochromatin. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. Interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the inner nuclear membrane.
  • Tissue specificityExpressed in all adult and embryonic tissues.
  • Sequence similaritiesContains 2 chromo domains.
  • Post-translational
    modifications
    Not phosphorylated.
    Ubiquitinated.
  • Cellular localizationNucleus. Unassociated with chromosomes during mitosis.
  • Information by UniProt

Recombinant Human CBX1 / HP1 beta protein images

  • 15% SDS-PAGE showing ab109847 at approximately 23.6 kDa (3µg).
  • Anti-CBX1 / HP1 beta antibody (ab10478) at 1/500 dilution + Recombinant Human CBX1 / HP1 beta protein (ab109847) at 0.01 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Exposure time : 10 seconds

References for Recombinant Human CBX1 / HP1 beta protein (ab109847)

ab109847 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"