Recombinant Human CBX1 / HP1 beta protein (ab109847)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGKKQNKKKVEEVLEEEEEEYVVEKVLDRR VVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKS EGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSG ELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDK KDDKN
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 185
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab109847 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.316% Tris HCl, 0.058% Sodium chloride, 0.0308% DTT, pH 8.0

General Info

  • Alternative names
    • CBX
    • CBX 1
    • Cbx1
    • CBX1_HUMAN
    • Chromobox 1
    • chromobox homolog 1
    • Chromobox homolog 1 (HP1 beta homolog Drosophila )
    • Chromobox protein homolog 1
    • Drosophila HP1 beta
    • Heterochromatin protein 1 beta
    • Heterochromatin protein 1 homolog beta
    • Heterochromatin protein p25
    • heterochromatin protein p25 beta
    • HP1 beta
    • HP1 beta homolog
    • HP1 beta homolog Drosophila
    • HP1, Drosophila. homolog of, beta
    • HP1beta
    • HP1Hs beta
    • HP1Hsbeta
    • Human heterochromatin protein p25 mRNA complete cds
    • M31
    • MOD 1
    • MOD1
    • Modifier 1 protein
    • p25beta
    see all
  • Function
    Component of heterochromatin. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. Interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the inner nuclear membrane.
  • Tissue specificity
    Expressed in all adult and embryonic tissues.
  • Sequence similarities
    Contains 2 chromo domains.
  • Post-translational
    modifications
    Not phosphorylated.
    Ubiquitinated.
  • Cellular localization
    Nucleus. Unassociated with chromosomes during mitosis.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab109847 at approximately 23.6 kDa (3µg).

References

ab109847 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up