Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKVGGCAGYADPTSQHPLGVG GRQREGLGPSGRGWHFCQQSVPLLGKQEPPFFLSLSFCCQGPQPAESSSP
    • Amino acids
      66 to 165
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153555 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cbx 2
    • CBX2
    • CBX2_HUMAN
    • CDC A6
    • CDCA6
    • Cell division cycle associated 6
    • Cell division cycle associated6
    • Chromobox homolog 2
    • chromobox homolog 2 (Pc class homolog, Drosophila)
    • Chromobox homolog2
    • Chromobox protein homolog 2
    • hromobox homolog 2
    • M33
    • M33 polycomb like
    • MOD 2
    • MOD2
    • Modifier 3
    • Modifier3
    • Pc class homolog
    • Polycomb
    • SRXY5
    see all
  • Function
    Component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Involved in sexual development, acting as activator of NR5A1 expression.
  • Involvement in disease
    Defects in CBX2 are the cause of 46,XY sex reversal type 5 (SRXY5) [MIM:613080]. It is a disorder of sex development. Affected individuals have a 46,XY karyotype but present as phenotypically normal females.
  • Sequence similarities
    Contains 1 A.T hook DNA-binding domain.
    Contains 1 chromo domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153555 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153555 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153555.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up