Overview

  • Product name
    Recombinant Human CBX4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MELPAVGEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILD PRLLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSS TDNRAKLDLGAQGKGQGHQYELNSKKHHHHAVGLNLSHVRKRCLSETHGE REPCKKRLTARSISTPTCLGGSPAAERPADLPPAAALPQPEVILLDSDLD EPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPA EAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV
    • Molecular weight
      58 kDa including tags
    • Amino acids
      1 to 290

Specifications

Our Abpromise guarantee covers the use of ab152885 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CBX 4
    • CBX4
    • Cbx4 chromobox homolog 4 (Drosophila Pc class)
    • CBX4_HUMAN
    • Chromobox homolog 4
    • Chromobox homolog 4 (Pc class homolog, Drosophila)
    • Chromobox protein homolog 4
    • E3 SUMO protein ligase CBX 4
    • E3 SUMO protein ligase CBX4
    • E3 SUMO-protein ligase CBX4
    • hPc 2
    • hPc2
    • NBP 16
    • NBP16
    • NS5ATP1 binding protein 16
    • Pc 2
    • Pc class 2 homolog
    • Pc class homolog
    • Pc class homolog Drosophila
    • PC2
    • Polycomb 2 homolog
    see all
  • Function
    E3 SUMO-protein ligase which facilitates SUMO1 conjugation by UBE2I. Component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.
  • Tissue specificity
    Ubiquitous.
  • Pathway
    Protein modification; protein sumoylation.
  • Sequence similarities
    Contains 1 chromo domain.
  • Post-translational
    modifications
    Phosphorylated on Thr-497 by HIPK2 upon DNA damage; which enhances E3 SUMO-protein ligase activity and promotes sumoylation on Lys-494.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152885 stained with Coomassie Blue.

References

ab152885 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152885.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up