Overview

  • Product name
    Recombinant Human CCBE1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLAS NTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPS PDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLM LADIRNDITELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPR RTETRDLRAPRDFYP
    • Amino acids
      1 to 215
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165553 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCBE 1
    • ccbe1
    • CCBE1_HUMAN
    • Collagen and calcium binding EGF domain containing protein 1
    • Collagen and calcium binding EGF domains 1
    • Collagen and calcium-binding EGF domain-containing protein 1
    • FLJ30681
    • Full of fluid protein homolog
    • MGC50861
    see all
  • Function
    Required for lymphangioblast budding and angiogenic sprouting from venous endothelium during embryogenesis.
  • Tissue specificity
    Not expressed in blood or lymphatic endothelial cells.
  • Involvement in disease
    Defects in CCBE1 are the cause of Hennekam lymphangiectasia-lymphedema syndrome (HLYLMP) [MIM:235510]. HLYLMP is a generalized lymph-vessels dysplasia characterized by intestinal lymphangiectasia with severe lymphedema of the limbs, genitalia and face. In addition, affected individuals have unusual facies and severe mental retardation.
  • Sequence similarities
    Belongs to the CCBE1 family.
    Contains 2 collagen-like domains.
    Contains 1 EGF-like domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab165553 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165553 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165553.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up