Recombinant Human CCDC102B protein (ab164132)

Overview

  • Product name
    Recombinant Human CCDC102B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKPNLDGVDLFNNGGSGNGETKTGLRLKAINLPLENEVTEISALQVHLDE FQKILWKEREMRTALEKEIERLESALSLWKWKYEELKESKPKNVKEFDIL LGQHNDEMQELSGNIKEESKSQNSKDRVICELRAELERLQAENTSEWDKR EILEREKQGLERENRRLKIQVKEMEELLDKKNRLSANSQSPDFKMSQIDL QEKNQELLNLQHAYYKLNRQYQANIAELTHANNRVDQNEAEVKKLRLRVE ELKQGLNQKEDELDDSLNQIRKLQRSLDEEKERNENLETELRHLQNW
    • Amino acids
      1 to 297
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164132 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACY1L
    • aminoacylase 1-like1
    • AN
    • C102B_HUMAN
    • C18orf14
    • CCDC102B
    • chromosome 18 open reading frame 14
    • coiled-coil domain containing 102B
    • Coiled-coil domain-containing protein 102B
    • DKFZp434K1426
    • DKFZp686I08254
    • FLJ23594
    • HsT1731
    • MGC161726
    • MGC161728
    see all
  • Information by UniProt

Images

  • ab164132 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164132 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164132.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up