Recombinant Human CCDC16 protein (ab164864)

Overview

  • Product name
    Recombinant Human CCDC16 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASSASARTPAGKRVINQEELRRLMKEKQRLSTSRKRIESPFAKYNRLGQ LSCALCNTPVKSELLWQTHVLGKQHREKVAELKGAKEASQGSSASSAPQS VKRKAPDADDQDVKRAKATLVPQVQPSTSAWTTNFDKIGKEFIRATPSKP SGLSLLPDYEDEEEEEEEEEGDGERKRGDASKPLSDAQGKEHSVSSSREV TSSVLPNDFFSTNPPKAPIIPHSGSIEKAEIHEKVVERRENTAEALPEGF FDDPEVDARVRKVDAPKDQMDKEWDEFQKAMRQVNTISEAIVAEEDEEGR LDRQIGEIDEQIECYRRVEKLRNRQDEIKNKLKEILTIKELQKKEEENAD SDDEGELQDLLSQDWRVKGALL
    • Amino acids
      1 to 372
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Coiled Coil Domain Containing Protein 16
    • HGNC28291
    • MGC20398
    • OMCG1
    • SEL 13
    • sel-13 suppressor of lin-12 homolog
    • zinc finger protein 830
    see all
  • Relevance
    This gene encodes for a coiled coil domain containing 16 protein and is located on chromosome 17. The protein may act as a regulator of the cell cycle in embryos by participating in control of M phase.
  • Cellular localization
    Nuclear

Images

  • ab164864 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164864 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up