Recombinant Human CCDC59 protein (ab162212)

Overview

  • Product name
    Recombinant Human CCDC59 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAPVRRSAKWRPGGIEARGEGVSTVGYRNKNVRQKTWRPNHPQAFVGSVR EGQGFAFRRKLKIQQSYKKLLRKEKKAQTSLESQFTDRYPDNLKHLYLAE EERHRKQARKVDHPLSEQVHQPLLEEQCSIDEPLFEDQCSFDQPQPEEQC IKTVNSFTIPKKNKKKTSNQKAQEEYEQIQAKRAAKKQEFERRKQEREEA QRQYKKKKMEVFKILNKKTKKGQPNLNVQMEYLLQKIQEKC
    • Amino acids
      1 to 241
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162212 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BR22
    • CCDC 59
    • Ccdc59
    • Coiled coil domain containing 59
    • Coiled coil domain containing protein 59
    • Coiled-coil domain-containing protein 59
    • DKFZp686K1021
    • FLJ10294
    • HSPC128
    • TAP26
    • TAP26_HUMAN
    • Thyroid transcription factor 1 associated protein 26
    • Thyroid transcription factor 1-associated protein 26
    • TTF 1 associated protein 26
    • TTF 1 associated protein BR2
    • TTF-1-associated protein 26
    • TTF-1-associated protein BR2
    see all
  • Function
    Component of the transcription complexes of the pulmonary surfactant-associated protein-B (SFTPB) and -C (SFTPC). Enhances homeobox protein Nkx-2.1-activated SFTPB and SFTPC promoter activities.
  • Tissue specificity
    Ubiquitously expressed. In lung, expression is restricted to the alveolar epithelial cells.
  • Sequence similarities
    Belongs to the TAP26 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162212 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162212 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162212.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up