Recombinant Human CCDC91 protein (ab163055)

Overview

  • Product name
    Recombinant Human CCDC91 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPMWNKVSGVHLSPSSPEIVLDRDHSSSIGCLSSDAIISSPENTHAANSI VSQTIPKAQIQQSTHTHLDISLFPLGLTDEKSNGTIALVDDSEDPGANVS NIQLQQKISSLEIKLKVSEEEKQRIKQDVESLMEKHNVLEKGFLKEKEQE AISFQDRYKELQEKHKQELEDMRKAGHEALSIIVDEYKALLQSSVKQQVE AIEKQYISAIEKQAHKCEELLNAQHQRLLEMLDTEKELLKEKIKEALIQQ SQEQKEILEKCLEEERQRNKEALVSAAKLEKEAMKDAVLKVVEEERKNLE KAHAEERELWKTEHAKDQEKVSQEIQKAIQEQRKISQETVKAAIIEEQKR SEKAVEEAVKRTRDELIEYIKEQKRLDQVIRQRSLSSLELFLSCAQKQLS ALIATEPVDIE
    • Amino acids
      1 to 411
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163055 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCD91_HUMAN
    • CCDC91
    • Coiled coil domain containing 91
    • Coiled-coil domain-containing protein 91
    • GGA binding partner
    • GGA-binding partner
    • GGABP
    • HSD8
    • p56
    • p56 accessory protein
    see all
  • Function
    Involved in the regulation of membrane traffic through the trans-Golgi network (TGN).
  • Tissue specificity
    Widely expressed.
  • Cellular localization
    Membrane. Golgi apparatus > trans-Golgi network membrane. Colocalizes with GGA1 and GGA2. May be recruited to the TGN by GGA1 and GGA2.
  • Information by UniProt

Images

  • ab163055 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163055 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163055.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up