Overview

  • Product name
    Recombinant Human CCK4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KQPSSQDALQGRRALLRCEVEAPGPVHVYWLLDGAPVQDTERRFAQGSSL SFAAVDRLQDSGTFQCVARDDVTGEEARSANASFNIKWIEAGPVVLKHPA SEAEIQPQTQ
    • Molecular weight
      38 kDa including tags
    • Amino acids
      36 to 145
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114772 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 8430404F20Rik
    • CCK 4
    • CCK-4
    • Colon carcinoma kinase 4
    • Human colon carcinoma kinase 4 (CCK4) mRNA complete cds
    • Inactive tyrosine-protein kinase 7
    • mPTK7/CCK4
    • OTTHUMP00000217016
    • Protein tyrosine kinase PTK 7
    • Protein-tyrosine kinase 7
    • Pseudo tyrosine kinase receptor 7
    • PTK 7
    • PTK7
    • PTK7 protein tyrosine kinase
    • PTK7 protein tyrosine kinase 7
    • PTK7_HUMAN
    • Serum response factor
    • Srf
    • Tyrosine-protein kinase-like 7
    see all
  • Function
    Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell polarity, proliferation, actin cytoskeleton reorganization and apoptosis. Has a role in embryogenesis, epithelial tissue organization and angiogenesis.
  • Tissue specificity
    Highly expressed in lung, liver, pancreas, kidney, placenta and melanocytes. Weakly expressed in thyroid gland, ovary, brain, heart and skeletal muscle. Also expressed in erythroleukemia cells. But not expressed in colon.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Domain
    The protein kinase domain is predicted to be catalytically inactive.
  • Post-translational
    modifications
    MMP14 cleaves PTK7 between Pro-621 and Leu-622 generating an N-terminal soluble (70 kDa) fragment and a membrane C-terminal (50 kDa) fragment. Proteolysis by MMP14 regulates PTK7 function in non-canonical Wnt signaling pathway.
  • Cellular localization
    Membrane. Cell junction. Colocalizes with MMP14 at cell junctions. Also localizes at the leading edge of migrating cells.
  • Information by UniProt

Recombinant Human CCK4 protein images

  • ab114772 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human CCK4 protein (ab114772)

ab114772 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114772.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up